Pfam domain
Pfam family: KH_5 (PF13184.8)
Uniprot AC: P9WIV3
RecName: Transcription termination/antitermination protein NusA
Begin-End: 214-282
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
AGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSELSGEKIDIIDYDDDPARFVANALS
PAKVVSVSV
Structures of the domain P9WIV3 214-282
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2asb X-ray 1.5 A 214-282 None
2atw X-ray 2.25 C 214-282 None
2atw X-ray 2.25 A 214-282 None


© NPIDB team 2003 - 2021

text