Pfam domain
Pfam family: CarD_CdnL_TRCF (PF02559.18)
Uniprot AC: P9WJG3
RecName: RNA polymerase-binding transcription factor CarD
Begin-End: 3-111
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
FKVGDTVVYPHHGAALVEAIETRTIKGEQKEYLVLKVAQGDLTVRVPAENAEYVGVRDVV
GQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKVAEVVRDL
Structures of the domain P9WJG3 3-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6vw0 X-ray 3.59 M 3-111  H-Bb H-Mn L-Bb 
6vvx X-ray 3.39 M 3-111  H-Bb H-Mn 
6eec X-ray 3.55 M 3-111  H-Bb 
6edt X-ray 0 M 3-111  H-Bb 
6ee8 X-ray 3.92 M 3-111  H-Bb L-Bb 
6vvy X-ray 3.42 M 3-111  H-Bb 
6vvz X-ray 3.72 M 3-111  H-Bb 


© NPIDB team 2003 - 2021

text