Pfam domain
Pfam family: HMG_box_2 (PF09011.12)
Uniprot AC: Q00059
RecName: Transcription factor A, mitochondrial
Begin-End: 152-219
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
LGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRY
HNEMKSWE
Structures of the domain Q00059 152-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3tmm X-ray 2.5 A 110-178  H-Bb H-Mn L-Bb L-Mn 
6erp X-ray 4.5 G 152-219  L-Bb L-Mn 
6erp X-ray 4.5 C 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nod X-ray 2.9 H 152-219  H-Bb H-Mn L-Bb 
4nod X-ray 2.9 A 152-219  H-Bb H-Mn L-Bb 
4nod X-ray 2.9 B 152-219  H-Bb H-Mn L-Bb 
4nod X-ray 2.9 G 152-219  H-Bb H-Mn L-Bb 
3tq6 X-ray 2.45 A 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
3tq6 X-ray 2.45 B 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 B 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 A 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 B 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
4nnu X-ray 2.81 A 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6erq X-ray 4.5 G 152-219  L-Bb L-Mn 
6erq X-ray 4.5 C 152-219  H-Bb H-Mj H-Mn L-Bb 
6hb4 X-ray 3.05 A 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hb4 X-ray 3.05 J 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hb4 X-ray 3.05 G 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hb4 X-ray 3.05 D 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 A 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 D 152-219  H-Bb H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 G 152-219  H-Bb H-Mj H-Mn L-Bb L-Mn 
6hc3 X-ray 3.1 J 152-219  H-Bb H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text