Pfam domain
Pfam family: TF_Zn_Ribbon (PF08271.11)
Uniprot AC: Q00403
RecName: Transcription initiation factor IIB
Begin-End: 13-54
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRT
Structures of the domain Q00403 13-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 M 14-55 None
5iya X-ray 5.4 M 14-54 None
5iy8 X-ray 7.9 M 14-55 None
5iyd X-ray 3.9 M 14-55 None
5iy6 X-ray 7.2 M 14-54 None
5iyc X-ray 3.9 M 14-55 None
5iy9 X-ray 6.3 M 14-55 None
5iyb X-ray 3.9 M 14-55 None


© NPIDB team 2003 - 2019

text