Pfam domain
Pfam family: TFIIB (PF00382.18)
Uniprot AC: Q00403
RecName: Transcription initiation factor IIB
Begin-End: 215-285
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
MSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEI
GDIAGVADVTI
Structures of the domain Q00403 215-285
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 M 215-285  H-Bb L-Bb 
5iya X-ray 5.4 M 215-285  H-Bb L-Bb L-Mj 
1vol X-ray 2.7 A 215-285  H-Bb L-Bb 
1c9b X-ray 2.65 Q 215-285  H-Bb H-Mj L-Bb L-Mj 
1c9b X-ray 2.65 A 215-285 None
1c9b X-ray 2.65 M 215-285 None
1c9b X-ray 2.65 I 215-285 None
1c9b X-ray 2.65 E 215-285 None
5iy8 X-ray 7.9 M 215-285  H-Bb H-Mj L-Bb L-Mj 
5iyd X-ray 3.9 M 215-285  H-Bb H-Mj L-Bb L-Mj 
5iy6 X-ray 7.2 M 215-285  H-Bb H-Mj L-Bb L-Mj 
5iyc X-ray 3.9 M 215-285  H-Bb H-Mj L-Bb L-Mj 
5iy9 X-ray 6.3 M 215-285  H-Bb H-Mj L-Bb L-Mj 
5iyb X-ray 3.9 M 215-285  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text