Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: Q00422
RecName: GA-binding protein alpha chain
Begin-End: 321-400
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
QLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRY
YYDGDMICKVQGKRFVYKFV
Structures of the domain Q00422 321-400
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1awc X-ray 2.15 A 321-400  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text