Pfam domain
Pfam family: HSF_DNA-bind (PF00447.16)
Uniprot AC: Q00613
RecName: Heat shock factor protein 1
Begin-End: 18-118
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
FLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYG
FRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRK
Structures of the domain Q00613 18-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d5v X-ray 2.55 D 18-118  H-Bb H-Mj L-Bb 
5d5v X-ray 2.55 B 18-118  H-Bb H-Mj S-Bb L-Bb 
5hdn X-ray 1.68 B 18-118 None
5hdn X-ray 1.68 A 18-118  H-Bb L-Bb L-Mj 
5hdn X-ray 1.68 C 18-118  L-Bb L-Mj 
5hdn X-ray 1.68 D 18-118 None


© NPIDB team 2003 - 2020

text