Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q00653
RecName: Nuclear factor NF-kappa-B p100 subunit
Begin-End: 40-220
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
LVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHS
DPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRL
RSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHD
S
Structures of the domain Q00653 40-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3do7 X-ray 3.05 B 40-220 None
1a3q X-ray 2.1 A 40-220  S-Bb S-Mj L-Bb L-Mj 
1a3q X-ray 2.1 B 40-220  H-Bb H-Mj S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text