Pfam domain
Pfam family: U1snRNP70_N (PF12220.7)
Uniprot AC: Q00916
RecName: U1 small nuclear ribonucleoprotein 70 kDa homolog
Begin-End: 6-97
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SKYPDDVSRLFKPRPPLSYKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFPEGSPN
NHLQRYEDIKLSKIKNAQLLDRRLQNWNPNVD
Structures of the domain Q00916 6-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uz5 X-ray 3.56 A 6-91 None


© NPIDB team 2003 - 2020

text