Pfam domain
Pfam family: Aconitase_C (PF00694.18)
Uniprot AC: Q01059
RecName: Cytoplasmic aconitate hydratase
Begin-End: 692-821
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
AARYLTNRGLTPREFNSYGSRRGNDAIMARGTFANIRLLNRFLNKQAPQTIHLPSGETLD
VFDAAERYQQEGHPLIVLAGKEYGSGSSRDWAAKGPFLLGIKAVLAESYERIHRSNLVGM
GVIPLEYLPG
Structures of the domain Q01059 692-821
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3sn2 X-ray 2.99 A 693-818 None
3snp X-ray 2.8 A 693-818 None
3snp X-ray 2.8 B 693-818 None


© NPIDB team 2003 - 2019

text