Pfam domain
Pfam family: RNA_pol_I_A49 (PF06870.11)
Uniprot AC: Q01080
RecName: DNA-directed RNA polymerase I subunit RPA49
Begin-End: 33-115
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGLFNPEKKSIQLYK
APVLVSKVVSKSSKNLRGPKIKS
Structures of the domain Q01080 33-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w65 X-ray 4.3 M 33-111 None
5w5y X-ray 3.8 M 33-111 None
5w64 X-ray 4.2 M 33-111 None
5oa1 X-ray 4.4 M 33-112 None
5m3f X-ray 3.8 M 33-113 None


© NPIDB team 2003 - 2019

text