Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: Q01167
RecName: Forkhead box protein K2
Begin-End: 257-343
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYF
IKVPRSQEEPGKGSFWRIDPASESKLI
Structures of the domain Q01167 257-343
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2c6y X-ray 2.4 A 3-87  H-Bb H-Mj S-Bb L-Bb L-Mn 
2c6y X-ray 2.4 B 3-87  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2020

text