Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: Q01543
RecName: Friend leukemia integration 1 transcription factor
Begin-End: 282-361
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
QLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRY
YYDKNIMTKVHGKRYAYKFD
Structures of the domain Q01543 282-361
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jvt X-ray 3.1 A 282-360  H-Bb H-Mj S-Bb L-Bb 
5jvt X-ray 3.1 D 282-360  H-Bb H-Mj S-Bb L-Bb 
5jvt X-ray 3.1 G 282-360  H-Bb H-Mj S-Bb L-Bb 
5e8i X-ray 3.45 A 282-360  H-Bb H-Mj S-Bb L-Bb 
5e8i X-ray 3.45 G 282-360  H-Bb H-Mj S-Bb L-Bb 
5e8i X-ray 3.45 J 282-360  H-Bb H-Mj S-Bb L-Bb 
5e8i X-ray 3.45 D 282-360  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text