Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: Q01855
RecName: 40S ribosomal protein S15
Begin-End: 43-128
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAF
NQVEIRPEMLGHYLGEFSITYTPVRH
Structures of the domain Q01855 43-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 P 43-128 None
6eml X-ray 3.6 E 235-320 None


© NPIDB team 2003 - 2019

text