Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q02260
RecName: Small nuclear ribonucleoprotein Sm D1
Begin-End: 5-97
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPQPRLNKLNSNGIAMAS
LYLTGGQQPTASDNIASLQYINIRGNTIRQIIL
Structures of the domain Q02260 5-97
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 V 160-230 None
5wsg X-ray 4 m 486-97 None
5gmk X-ray 3.4 z 12-77 None
5gmk X-ray 3.4 m 486-97 None
6bk8 X-ray 3.3 h 5-97 None
6bk8 X-ray 3.3 p 5-97 None
5lj3 X-ray 3.8 l 5-97 None
5lj3 X-ray 3.8 h 5-97 None
5mps X-ray 3.85 h 5-97 None
5lj5 X-ray 3.8 l 6-71 None
5lj5 X-ray 3.8 h 15-82 None
3jcm X-ray 3.8 P 5-79 None
3jcm X-ray 3.8 T 5-79 None
5gam X-ray 3.7 h 5-97 None
5uz5 X-ray 3.56 L 5-97 None
5gao X-ray 3.6 l 5-97 None


© NPIDB team 2003 - 2019

text