Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: Q02486
RecName: ARS-binding factor 2, mitochondrial
Begin-End: 116-182
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
PKKPAGPFIKYANEVRSQVFAQHPDKSQLDLMKIIGDKWQSLDQSIKDKYIQEYKKAIQE
YNARYPL
Structures of the domain Q02486 116-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jgh X-ray 2.6 A 116-181  H-Bb H-Mj H-Mn L-Bb L-Mn 
5jgh X-ray 2.6 D 116-181  H-Bb H-Mn L-Bb 
5jgh X-ray 2.6 J 116-181  H-Bb H-Mj H-Mn L-Bb L-Mn 
5jgh X-ray 2.6 G 116-181  H-Bb L-Bb L-Mj L-Mn 
5jh0 X-ray 2.18 D 116-181  H-Bb H-Mj H-Mn 
5jh0 X-ray 2.18 A 116-181  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2019

text