Pfam domain
Pfam family: NOG1 (PF06858.13)
Uniprot AC: Q02892
RecName: Nucleolar GTP-binding protein 1
Begin-End: 234-288
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NIEMQSIYAIAHLRSCVLYFMDLSEQCGFTIEAQVKLFHSIKPLFANKSVMVVIN
Structures of the domain Q02892 234-288
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 b 274-328 None


© NPIDB team 2003 - 2019

text