Pfam domain
Pfam family: NOGCT (PF08155.10)
Uniprot AC: Q02892
RecName: Nucleolar GTP-binding protein 1
Begin-End: 396-449
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RKLARDIEAENGGAGVFNVNLKDKYLLEDDEWKNDIMPEILDGKNVYDFLDPEI
Structures of the domain Q02892 396-449
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 b 396-449 None


© NPIDB team 2003 - 2019

text