Pfam domain
Pfam family: zf-CXXC (PF02008.19)
Uniprot AC: Q03164
RecName: Histone-lysine N-methyltransferase 2A
Begin-End: 1147-1194
Organism: Homo sapiens
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
KKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKC
Structures of the domain Q03164 1147-1194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2kkf NMR A 1148-1194  L-Bb L-Mj L-Mn 
4nw3 X-ray 2.82 A 1150-1194  S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text