Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: Q03164
RecName: Histone-lysine N-methyltransferase 2A
Begin-End: 3840-3945
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHG
NAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYK
Structures of the domain Q03164 3840-3945
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kix X-ray 4.1 K 3840-3945 None
6pww X-ray 4.4 C 3840-3945 None
6kiu X-ray 3.2 K 3840-3945 None
6pwv X-ray 6.2 C 3840-3945 None
6kiz X-ray 4.5 K 3840-3945 None
6kiv X-ray 4 K 3840-3945  S-Bb 


© NPIDB team 2003 - 2021

text