Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: Q031W6
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 132-221
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
IGPEPTYEDFDEKLFREKLRKSTKKIKPYLLEQTLVAGLGNIYVDEVLWLAKIHPEKEAN
QLTESSIHLLHDSIIEILQKAIKLGGSSIR
Structures of the domain Q031W6 132-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cis X-ray 2.05 B 131-220 None
4cis X-ray 2.05 A 131-228 None


© NPIDB team 2003 - 2019

text