Pfam domain
Pfam family: PRP3 (PF08572.9)
Uniprot AC: Q03338
RecName: U4/U6 small nuclear ribonucleoprotein PRP3
Begin-End: 140-318
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLDEKGELMEKYDMNGTSPAEEKLAED
IDEVDDDDDDEHPSIRYVAHPLPEKINEAKVSIKAYLTQHERKRLRRNRRKMAREAREIK
IKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRKHLEENERRHED
Structures of the domain Q03338 140-318
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcm X-ray 3.8 K 224-317 None


© NPIDB team 2003 - 2020

text