Pfam domain
Pfam family: DUF1115 (PF06544.11)
Uniprot AC: Q03338
RecName: U4/U6 small nuclear ribonucleoprotein PRP3
Begin-End: 340-466
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKR
IKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFD
SEHFYSP
Structures of the domain Q03338 340-466
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yhw X-ray 3.25 A 340-465 None
4yhw X-ray 3.25 B 340-465 None
3jcm X-ray 3.8 K 340-464 None
5gap X-ray 3.6 G 340-465 None


© NPIDB team 2003 - 2020

text