Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: Q03654
RecName: Pre-mRNA-splicing factor CEF1
Begin-End: 10-56
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYL
Structures of the domain Q03654 10-56
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 c 69-114 None
5gmk X-ray 3.4 c 11-56 None
6bk8 X-ray 3.3 S 10-58 None
5mps X-ray 3.85 O 11-56 None


© NPIDB team 2003 - 2020

text