Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: Q03654
RecName: Pre-mRNA-splicing factor CEF1
Begin-End: 63-106
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TEFSKEEDAQLLDLARELPNQWRTIADMMARPAQVCVERYNRLL
Structures of the domain Q03654 63-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 c 122-164 None
5gmk X-ray 3.4 c 64-106 None
5mps X-ray 3.85 O 64-106 None


© NPIDB team 2003 - 2020

text