Pfam domain
Pfam family: HSF_DNA-bind (PF00447.16)
Uniprot AC: Q03933
RecName: Heat shock factor protein 2
Begin-End: 10-110
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
FLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYG
FRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRK
Structures of the domain Q03933 10-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d8l X-ray 2.07 D 10-110  H-Bb H-Mj S-Bb L-Bb L-Mj 
5d8l X-ray 2.07 B 10-110  H-Bb H-Mj S-Bb L-Bb L-Mj 
5d8l X-ray 2.07 H 10-110  H-Bb H-Mj S-Bb L-Bb L-Mj 
5d8l X-ray 2.07 F 10-110  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text