Pfam domain
Pfam family: HNH_4 (PF13395.8)
Uniprot AC: Q03LF7
RecName: CRISPR-associated endonuclease Cas9 1
Begin-End: 576-631
Organism: Streptococcus thermophilus
Interaction Mode:   

Sequence:
CLYTGKTISIHDLINNSNQFEVDHILPLSITFDDSLANKVLVYATANQEKGQRTPY
Structures of the domain Q03LF7 576-631
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m0x X-ray 2.56 A 576-631 None
6m0v X-ray 3 A 576-631 None
6m0w X-ray 2.76 A 576-631 None


© NPIDB team 2003 - 2021

text