Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: Q03LF7
RecName: CRISPR-associated endonuclease Cas9 1
Begin-End: 674-731
Organism: Streptococcus thermophilus
Interaction Mode:  L-Bb L-Mj L-Mn 

Sequence:
DVRKKFIERNLVDTRYASRVVLNALQEHFRAHKIDTKVSVVRGQFTSQLRRHWGIEKT
Structures of the domain Q03LF7 674-731
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m0x X-ray 2.56 A 671-731  L-Bb L-Mj L-Mn 
6m0v X-ray 3 A 671-731  L-Mj L-Mn 
6m0w X-ray 2.76 A 671-732  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text