Pfam domain
Pfam family: Cas9_PI2 (PF18070.3)
Uniprot AC: Q03LF7
RecName: CRISPR-associated endonuclease Cas9 1
Begin-End: 964-1024
Organism: Streptococcus thermophilus
Interaction Mode:  S-Bb 

Sequence:
PWRADVYFNKTTGKYEILGLKYADLQFEKGTGTYKISQEKYNDIKKKEGVDSDSEFKFTL
Y
Structures of the domain Q03LF7 964-1024
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rjd X-ray 3.3 C 964-1024 None
6rjg X-ray 3.2 C 964-1024 None
6m0x X-ray 2.56 A 964-1024  S-Bb 
6m0v X-ray 3 A 964-1024  S-Bb 
6m0w X-ray 2.76 A 964-1024  S-Bb 
6rja X-ray 3 F 964-1024 None
6rja X-ray 3 C 964-1024 None
6rj9 X-ray 3.2 C 964-1024 None


© NPIDB team 2003 - 2021

text