Pfam domain
Pfam family: IMS_HHH (PF11798.10)
Uniprot AC: Q04049
RecName: DNA polymerase eta
Begin-End: 289-323
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb L-Bb 

Sequence:
DCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLP
Structures of the domain Q04049 289-323
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r8k X-ray 3.3 B 288-322  H-Bb 
2r8k X-ray 3.3 A 288-322 None
3oha X-ray 2 A 288-322  H-Bb L-Bb 
3mfi X-ray 1.76 A 288-322  H-Bb L-Bb 
2r8j X-ray 3.1 B 288-322  H-Bb 
2r8j X-ray 3.1 A 288-322  H-Bb L-Bb 
2wtf X-ray 2.5 B 288-322  H-Bb 
2wtf X-ray 2.5 A 288-322  H-Bb 
2xgq X-ray 2.7 A 288-322  H-Bb 
2xgq X-ray 2.7 B 288-322  H-Bb L-Bb 
3mfh X-ray 2 A 288-322  H-Bb L-Bb 
3ohb X-ray 2 A 288-322  H-Bb L-Bb 
2xgp X-ray 2.7 B 288-322  H-Bb L-Bb 
2xgp X-ray 2.7 A 288-322 None


© NPIDB team 2003 - 2021

text