Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q04206
RecName: Transcription factor p65
Begin-End: 21-186
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD
PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP
FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDN
Structures of the domain Q04206 21-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2o61 X-ray 2.8 A 21-186  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
3gut X-ray 3.59 C 21-186  S-Mj L-Bb L-Mj 
3gut X-ray 3.59 A 21-186  S-Mj L-Bb L-Mj 
3gut X-ray 3.59 G 21-186  L-Bb L-Mj 
3gut X-ray 3.59 E 21-186  S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text