Pfam domain
Pfam family: RHD_dimer (PF16179.4)
Uniprot AC: Q04207
RecName: Transcription factor p65
Begin-End: 195-291
Organism: Mus musculus
Interaction Mode:  S-Bb L-Bb 

Sequence:
KICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRT
PPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
Structures of the domain Q04207 195-291
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ram X-ray 2.7 B 195-291  S-Bb L-Bb 
1ram X-ray 2.7 A 195-291  L-Bb 
2ram X-ray 2.4 A 195-291 None
2ram X-ray 2.4 B 195-291 None
1lei X-ray 2.7 A 195-291 None
1le5 X-ray 2.75 A 195-291  L-Bb 
1le5 X-ray 2.75 E 195-291  L-Bb 
1vkx X-ray 2.9 A 195-291  L-Bb 
2i9t X-ray 2.8 A 195-291 None
1le9 X-ray 3 E 195-291 None
1le9 X-ray 3 A 195-291 None
5u01 X-ray 2.5 D 195-291  L-Bb 
5u01 X-ray 2.5 C 195-291 None
5u01 X-ray 2.5 B 195-291  L-Bb 
5u01 X-ray 2.5 A 195-291  L-Bb 


© NPIDB team 2003 - 2019

text