Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q04207
RecName: Transcription factor p65
Begin-End: 21-186
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
VEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKD
PPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP
FHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDN
Structures of the domain Q04207 21-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ram X-ray 2.7 B 21-186  L-Bb L-Mj 
1ram X-ray 2.7 A 21-186  H-Bb H-Mj S-Mj L-Bb L-Mj 
2ram X-ray 2.4 B 21-186 None
2ram X-ray 2.4 A 21-186 None
1lei X-ray 2.7 A 21-186 None
1le5 X-ray 2.75 A 21-186  L-Bb L-Mj 
1le5 X-ray 2.75 E 21-186  S-Mj L-Bb L-Mj 
1vkx X-ray 2.9 A 21-186  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i9t X-ray 2.8 A 21-186  H-Bb H-Mj S-Mj L-Bb L-Mj 
1le9 X-ray 3 E 21-186 None
1le9 X-ray 3 A 21-186 None
5u01 X-ray 2.5 D 21-186  H-Bb H-Mj L-Bb L-Mj 
5u01 X-ray 2.5 C 21-186  H-Bb S-Bb S-Mj L-Bb L-Mj 
5u01 X-ray 2.5 B 21-186  H-Bb S-Mj L-Bb L-Mj 
5u01 X-ray 2.5 A 21-186  H-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text