Pfam domain
Pfam family: Ku_N (PF03731.14)
Uniprot AC: Q04437
RecName: ATP-dependent DNA helicase II subunit 2
Begin-End: 5-232
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
STTFIVDVSPSMMKNNNVSKSMAYLEYTLLNKSKKSRKTDWISCYLANCPVSENSQEIPN
VFQIQSFLAPVTTTATIGFIKRLKQYCDQHSHDSSNEGLQSMIQCLLVVSLDIKQQFQAR
KILKQIVVFTDNLDDLDITDEEIDLLTEELSTRIILIDCGKDTQEERKKSNWLKLVEAIP
NSRIYNMNELLVEITSPATSVVKPVRVFSGELRLGADILSTQTSNPSG
Structures of the domain Q04437 5-232
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5y58 X-ray 2.8 B 5-231 None
5y58 X-ray 2.8 D 5-231 None
5y58 X-ray 2.8 F 5-231 None


© NPIDB team 2003 - 2019

text