Pfam domain
Pfam family: BOP1NT (PF08145.11)
Uniprot AC: Q04660
RecName: Ribosome biogenesis protein ERB1
Begin-End: 165-426
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YDEMPHIGYDINGKRIMRPAKGSALDQLLDSIELPEGWTGLLDKNSGSSLNLTKEELELI
SKIQRNEQTDDSINPYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIR
EGRIIPPKKLKEMKEKEKIENYQYDLWGDSTETNDHVMHLRAPKLPPPTNEESYNPPEEY
LLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNK
LNIDPNSLIPELPSPKDLRPFP
Structures of the domain Q04660 165-426
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 m 165-426 None


© NPIDB team 2003 - 2019

text