Pfam domain
Pfam family: BOP1NT (PF08145.11)
Uniprot AC: Q04660
RecName: Ribosome biogenesis protein ERB1
Begin-End: 244-397
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIREGRIIPPKKLKEMKEKEKI
ENYQYDLWGDSTETNDHVMHLRAPKLPPPTNEESYNPPEEYLLSPEEKEAWENTEYSERE
RNFIPQKYSALRKVPGYGESIRERFERSLDLYLA
Structures of the domain Q04660 244-397
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 H 2-397 None
6em3 X-ray 3.2 B 244-397 None


© NPIDB team 2003 - 2019

text