Pfam domain
Pfam family: WD40 (PF00400.31)
Uniprot AC: Q04660
RecName: Ribosome biogenesis protein ERB1
Begin-End: 427-465
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IRCSTIYAGHKGKVRTLSIDPSGLWLATGSDDGTVRVWE
Structures of the domain Q04660 427-465
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 m 428-464 None
6em5 X-ray 4.3 m 766-805 None


© NPIDB team 2003 - 2019

text