Pfam domain
Pfam family: RNA_pol_I_TF (PF04090.11)
Uniprot AC: Q04712
RecName: RNA polymerase I-specific transcription initiation factor RRN11
Begin-End: 204-383
Organism: Saccharomyces cerevisiae
Interaction Mode:  L-Bb 

Sequence:
EVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPGVQIKSLWGIGVEILDNLSN
SSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKS
MEPSSNIIDKPFDTENDLLQELIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQF
Structures of the domain Q04712 204-383
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oa1 X-ray 4.4 W 204-383  L-Bb 


© NPIDB team 2003 - 2019

text