Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: Q04863
RecName: Transcription factor RelB
Begin-End: 105-273
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
LVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVW
KDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLG
IDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDK
Structures of the domain Q04863 105-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3do7 X-ray 3.05 A 105-273 None
2v2t X-ray 3.05 A 105-273  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text