Pfam domain
Pfam family: RHD_dimer (PF16179.7)
Uniprot AC: Q04863
RecName: Transcription factor RelB
Begin-End: 282-378
Organism: Mus musculus
Interaction Mode:   

Sequence:
RICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKT
PPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPR
Structures of the domain Q04863 282-378
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3do7 X-ray 3.05 A 282-379  L-Bb 
2v2t X-ray 3.05 A 282-378  L-Bb 


© NPIDB team 2003 - 2021

text