Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: Q04887
RecName: Transcription factor SOX-9
Begin-End: 105-173
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQ
HKKDHPDYK
Structures of the domain Q04887 105-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s2q X-ray 2.7 D 68-136  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2020

text