Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: Q05066
RecName: Sex-determining region Y protein
Begin-End: 60-128
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
VKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAM
HREKYPNYK
Structures of the domain Q05066 60-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j47 NMR A 5-73  H-Bb H-Mn L-Bb L-Mn 
1j46 NMR A 5-73  H-Bb H-Mn L-Bb L-Mn 
1hry NMR A 5-73 None
2gzk NMR A 5-73  H-Bb H-Mj H-Mn L-Bb L-Mn 
1hrz NMR A 5-73 None


© NPIDB team 2003 - 2020

text