Pfam domain
Pfam family: tRNA-synt_1d (PF00750.18)
Uniprot AC: Q05506
RecName: Arginine--tRNA ligase, cytoplasmic
Begin-End: 123-475
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VIPDILTRKEDYGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLANLYEKLGWE
VIRMNYLGDWGKQFGLLAVGFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQ
STNGKAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYARLNIKYDVYSGESQVSKESM
LKAIDLFKEKGLTHEDKGAVLIDLTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYEKY
HFDKMIYVIASQQDLHAAQFFEILKQMGFEWAKDLQHVNFGMVQGMSTRKGTVVFLDNIL
EETKEKMHEVMKKNENKYAQIEHPEEVADLVGISAVMIQDMQGKRINNYEFKW
Structures of the domain Q05506 123-475
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f7u X-ray 2.2 A 124-475 None
1f7v X-ray 2.9 A 124-475 None


© NPIDB team 2003 - 2019

text