Pfam domain
Pfam family: Arg_tRNA_synt_N (PF03485.15)
Uniprot AC: Q05506
RecName: Arginine--tRNA ligase, cytoplasmic
Begin-End: 33-114
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
DLMRNYISQELSKISGVDSSLIFPALEWTNTMERGDLLIPIPRLRIKGANPKDLAVQWAE
KFPCGDFLEKVEANGPFIQFFF
Structures of the domain Q05506 33-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f7u X-ray 2.2 A 35-114 None
1f7v X-ray 2.9 A 35-114 None


© NPIDB team 2003 - 2019

text