Pfam domain
Pfam family: DALR_1 (PF05746.14)
Uniprot AC: Q05506
RecName: Arginine--tRNA ligase, cytoplasmic
Begin-End: 489-607
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPT
TVVTYLFKLTHQVSSCYDVLWVAGQTEELATARLALYGAARQVLYNGMRLLGLTPVERM
Structures of the domain Q05506 489-607
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f7u X-ray 2.2 A 489-607 None
1f7v X-ray 2.9 A 489-607 None


© NPIDB team 2003 - 2019

text