Pfam domain
Pfam family: HMG_box (PF00505.18)
Uniprot AC: Q05783
RecName: High mobility group protein D
Begin-End: 5-71
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mn 

Sequence:
PKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYD
RAVKEFE
Structures of the domain Q05783 5-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3nm9 X-ray 2.85 P 5-70 None
3nm9 X-ray 2.85 M 5-70  H-Bb L-Bb 
3nm9 X-ray 2.85 J 5-70 None
3nm9 X-ray 2.85 G 5-70  H-Bb H-Mj H-Mn L-Bb L-Mn 
3nm9 X-ray 2.85 D 5-70  H-Bb L-Bb L-Mn 
3nm9 X-ray 2.85 A 5-70  H-Bb L-Bb 
1e7j NMR A 5-70 None
1qrv X-ray 2.2 B 5-70 None
1qrv X-ray 2.2 A 5-70 None


© NPIDB team 2003 - 2019

text