Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q06217
RecName: Small nuclear ribonucleoprotein Sm D2
Begin-End: 37-106
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFL
RGDSVIVVLK
Structures of the domain Q06217 37-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 g 36-104 None
5gmk X-ray 3.4 g 41-104 None
6bk8 X-ray 3.3 a 41-104 None
6bk8 X-ray 3.3 q 41-104 None
5lj3 X-ray 3.8 m 29-92 None
5lj3 X-ray 3.8 j 137-200 None
5mps X-ray 3.85 j 136-199 None
5lj5 X-ray 3.8 m 29-92 None
5lj5 X-ray 3.8 j 41-104 None
3jcm X-ray 3.8 Q 41-104 None
3jcm X-ray 3.8 U 41-104 None
5gam X-ray 3.7 j 41-104 None
5uz5 X-ray 3.56 M 41-104 None
5gao X-ray 3.6 m 41-104 None


© NPIDB team 2003 - 2019

text