Pfam domain
Pfam family: LSM (PF01423.21)
Uniprot AC: Q06217
RecName: Small nuclear ribonucleoprotein Sm D2
Begin-End: 44-106
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIV
VLK
Structures of the domain Q06217 44-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wsg X-ray 4 W 44-104 None
5gmk X-ray 3.4 e 44-104 None


© NPIDB team 2003 - 2019

text