Pfam domain
Pfam family: PhdYeFM_antitox (PF02604.21)
Uniprot AC: Q06253
RecName: Antitoxin phd
Begin-End: 1-55
Organism: Escherichia phage P1
Interaction Mode:   

Sequence:
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAE
Structures of the domain Q06253 1-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4zm2 X-ray 3.88 C 1-55  H-Bb H-Mj S-Bb L-Bb L-Mn 
4zm2 X-ray 3.88 D 1-53  H-Bb H-Mj S-Bb L-Bb 
4zm2 X-ray 3.88 A 1-52  H-Bb H-Mj S-Bb 
4zm0 X-ray 3.17 C 1-55  H-Bb H-Mj L-Mn 
4zm0 X-ray 3.17 D 1-54  H-Bb H-Mj S-Bb L-Mn 
4zm0 X-ray 3.17 A 1-55  H-Bb H-Mj S-Bb L-Bb L-Mn 
4zm0 X-ray 3.17 B 1-55  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text