Pfam domain
Pfam family: BTD (PF09270.12)
Uniprot AC: Q06330
RecName: Recombining binding protein suppressor of hairless
Begin-End: 206-328
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIR
KVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMINDG
ASW
Structures of the domain Q06330 206-328
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2f8x X-ray 3.25 C 192-314  S-Bb 
3nbn X-ray 3.45 D 192-314 None
3nbn X-ray 3.45 A 192-314  S-Bb L-Bb 
3v79 X-ray 3.85 C 192-314  S-Bb 
6py8 X-ray 3.75 E 192-314  S-Bb 
6py8 X-ray 3.75 C 192-314  S-Bb 


© NPIDB team 2003 - 2021

text